PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_6A7EFC4661.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 290aa    MW: 30212.5 Da    PI: 5.9728
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_6A7EFC4661.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-3944105263
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                             +e+a+kcprC+stntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+sss
  Traes_6DL_6A7EFC4661.2  44 PEAAVKCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKAKRSSS 105
                             67899*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-274397IPR003851Zinc finger, Dof-type
PfamPF027011.8E-3347102IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.32948102IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105086IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MQDFQSIPGL AGRLFGGAAA ADIRRVQGPA SRCGVFSQAA SAQPEAAVKC PRCESTNTKF  60
CYYNNYNLSQ PRHFCKSCRR YWTKGGVLRN VPVGGGCRKA KRSSSSASAP STPAATDAKS  120
QRRASSSSSS RSNSGSGSAS PTANGEDTPT TTTDPPPATP SSNSNANAVS FASRMTNYPF  180
AADVPPPAPI FADQAAALAS LFAPPPPPPL PVFSFSAEPK MEEAIGSLLL PGQEPAQEPE  240
EPTCTSTVAD MAPFMSLDAG IFELGDASPA DYWNGGSCWT DVQDPSVYLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9554930.0AY955493.2 Triticum aestivum Dof1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006647826.11e-100PREDICTED: dof zinc finger protein DOF5.4-like
TrEMBLW5GWY20.0W5GWY2_WHEAT; Uncharacterized protein
STRINGOB02G37970.11e-100(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64963050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.19e-33DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]